PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_77F235694.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 122aa    MW: 13741.2 Da    PI: 12.3962
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_77F235694.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.6e-16242547
                           -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           T++E+  +v+++ ++G++ W+tIar ++ gRt++++k++w+++
  Traes_2DL_77F235694.1  2 TPQEESTIVQLHSLWGNR-WSTIARSLP-GRTDNEIKNYWRTH 42
                           9*****************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.8E-10145IPR001005SANT/Myb domain
PROSITE profilePS5129422.097147IPR017930Myb domain
CDDcd001675.26E-10142No hitNo description
Gene3DG3DSA:1.10.10.602.5E-19243IPR009057Homeodomain-like
PfamPF002496.0E-14242IPR001005SANT/Myb domain
SuperFamilySSF466893.12E-12248IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MTPQEESTIV QLHSLWGNRW STIARSLPGR TDNEIKNYWR THYKKGKPSK NIERARARFL  60
MQRRGXARQG AVPDAAAGDA AAPATEAASW AGQGRRAPRR HRLGRRRREN GRRRRPGGDG  120
AG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096202e-63AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664226.15e-36PREDICTED: myb-related protein 330-like
TrEMBLW5BW891e-81W5BW89_WHEAT; Uncharacterized protein
STRINGLOC_Os04g42950.11e-35(Oryza sativa Japonica Group)
STRINGORGLA04G0153500.12e-35(Oryza glaberrima)
STRINGBGIOSGA014750-PA2e-35(Oryza sativa Indica Group)
STRINGOB04G25360.13e-35(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.12e-24myb domain protein 79
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]